rxn-aa-mapper
Reactions SMILES-AA sequence mapping
setup
conda env create -f conda.yml
conda activate rxn_aa_mapper
In the following we consider on examples provided to show how to use RXNAAMapper.
generate a vocabulary to be used with the EnzymaticReactionBertTokenizer
Create a vocabulary compatible with the enzymatic reaction tokenizer:
create-enzymatic-reaction-vocabulary ./examples/data-samples/biochemical ./examples/token_75K_min_600_max_750_500K.json /tmp/vocabulary.txt "*.csv"
use the tokenizer
Using the examples vocabulary and AA tokenizer provided, we can observe the enzymatic reaction tokenizer in action:
from rxn_aa_mapper.tokenization import EnzymaticReactionBertTokenizer
tokenizer = EnzymaticReactionBertTokenizer(
vocabulary_file="./examples/vocabulary_token_75K_min_600_max_750_500K.txt",
aa_sequence_tokenizer_filepath="./examples/token_75K_min_600_max_750_500K.json"
)
tokenizer.tokenize("NC(=O)c1ccc[n+]([C@@H]2O[[email protected]](COP(=O)(O)OP(=O)(O)OC[[email protected]]3O[C@@H](n4cnc5c(N)ncnc54)[[email protected]](O)[C@@H]3O)[C@@H](O)[[email protected]]2O)c1.O=C([O-])CC(C(=O)[O-])C(O)C(=O)[O-]|AGGVKTVTLIPGDGIGPEISAAVMKIFDAAKAPIQANVRPCVSIEGYKFNEMYLDTVCLNIETACFATIKCSDFTEEICREVAENCKDIK>>O=C([O-])CCC(=O)C(=O)[O-]")
train the model
The mlm-trainer script can be used to train a model via MTL:
mlm-trainer \
./examples/data-samples/biochemical ./examples/data-samples/biochemical \ # just a sample, simply split data in a train and a validation folder
./examples/vocabulary_token_75K_min_600_max_750_500K.txt /tmp/mlm-trainer-log \
./examples/sample-config.json "*.csv" 1 \ # for a more realistic config see ./examples/config.json
./examples/data-samples/organic ./examples/data-samples/organic \ # just a sample, simply split data in a train and a validation folder
./examples/token_75K_min_600_max_750_500K.json
Checkpoints will be stored in the /tmp/mlm-trainer-log for later usage in identification of active sites.
Those can be turned into an HuggingFace model by simply running:
checkpoint-to-hf-model /path/to/model.ckpt /tmp/rxnaamapper-pretrained-model ./examples/vocabulary_token_75K_min_600_max_750_500K.txt ./examples/sample-config.json ./examples/token_75K_min_600_max_750_500K.json
predict active site
The trained model can used to map reactant atoms to AA sequence locations that potentially represent the active site.
from rxn_aa_mapper.aa_mapper import RXNAAMapper
config_mapper = {
"vocabulary_file": "./examples/vocabulary_token_75K_min_600_max_750_500K.txt",
"aa_sequence_tokenizer_filepath": "./examples/token_75K_min_600_max_750_500K.json",
"model_path": "/tmp/rxnaamapper-pretrained-model",
"head": 3,
"layers": [11],
"top_k": 1,
}
mapper = RXNAAMapper(config=config_mapper)
mapper.get_reactant_aa_sequence_attention_guided_maps(["NC(=O)c1ccc[n+]([C@@H]2O[[email protected]](COP(=O)(O)OP(=O)(O)OC[[email protected]]3O[C@@H](n4cnc5c(N)ncnc54)[[email protected]](O)[C@@H]3O)[C@@H](O)[[email protected]]2O)c1.O=C([O-])CC(C(=O)[O-])C(O)C(=O)[O-]|AGGVKTVTLIPGDGIGPEISAAVMKIFDAAKAPIQANVRPCVSIEGYKFNEMYLDTVCLNIETACFATIKCSDFTEEICREVAENCKDIK>>O=C([O-])CCC(=O)C(=O)[O-]"])
citation
@article{dassi2021identification,
title={Identification of Enzymatic Active Sites with Unsupervised Language Modeling},
author={Dassi, Lo{\"\i}c Kwate and Manica, Matteo and Probst, Daniel and Schwaller, Philippe and Teukam, Yves Gaetan Nana and Laino, Teodoro},
year={2021}
conference={AI for Science: Mind the Gaps at NeurIPS 2021, ELLIS Machine Learning for Molecule Discovery Workshop 2021}
}
124 Dec 27, 2022
1 Jun 29, 2022
13 Nov 17, 2022
134 Dec 19, 2022
124 Dec 28, 2022
35 Nov 14, 2022
1 Dec 16, 2021
1 Feb 17, 2022
135 Dec 28, 2022
100 Dec 26, 2022
64 Dec 29, 2022
61 Dec 07, 2022
16 Dec 07, 2022
1 Dec 17, 2021
87 Jan 03, 2023
124 Dec 29, 2022
96 Dec 13, 2022
56 Dec 22, 2022
72 Dec 14, 2022
3 Jul 07, 2022